PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10005466m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 315aa    MW: 35237.1 Da    PI: 7.9475
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10005466mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.75.6e-331972255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWtpeLH++Fv+a+++LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Ciclev10005466m 19 PRLRWTPELHRCFVHAIDRLGGHQKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-321576IPR009057Homeodomain-like
PROSITE profilePS5129411.9651575IPR017930Myb domain
SuperFamilySSF466896.45E-161774IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-231972IPR006447Myb domain, plants
PfamPF002493.1E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGSCGRSGAV RQYIRSKVPR LRWTPELHRC FVHAIDRLGG HQKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMRSDLGRQ DKTQQRRQSS SEQHDRGCCI DEVNDLNHNH HMGFHDYPSS  120
ESIKKSDAQC IYNNINTPFL PSKSKARTET RGCSISDQNL QCSQGICETV SNPYPFDDYL  180
QQKQNNKAKE GYGTGAAFRY KQAHSNALSS PFSQPHDDDH LYTLKYAVAV EESDYILKNN  240
VLRGQAEDEE ADDFELSLGL SLPHPSSQRS NASSTSDIGA EAISLYSRSN AKDCFGSSRR  300
YNINLDLSIA LCGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006470870.10.0PREDICTED: two-component response regulator ARR12
TrEMBLA0A067ERQ00.0A0A067ERQ0_CITSI; Uncharacterized protein
STRINGVIT_01s0137g00050.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-37G2-like family protein